PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.093390.2
Common NameCsa_1G256210, WRKY4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 507aa    MW: 54874.6 Da    PI: 6.1728
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.093390.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY78.86e-25193249259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +DgynWrKYGqK+vk+ + +rsYY+Ct+++C +kk +e++++ ++++ei+Y+++H h+
  Cucsa.093390.2 193 SDGYNWRKYGQKQVKSPKGSRSYYKCTYSECFAKK-IECCDDSGQTTEIVYKSQHSHD 249
                     7********************************98.*********************7 PP

2WRKY98.35.1e-31368424359
                     -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k++e + e+p++v+itY+g H+h+
  Cucsa.093390.2 368 DGYRWRKYGQKMVKGNPHPRNYYRCTSAGCPVRKHIESAVENPNAVIITYKGVHDHD 424
                     9*******************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.488187251IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-21187251IPR003657WRKY domain
SuperFamilySSF1182902.88E-20190251IPR003657WRKY domain
SMARTSM007747.8E-24192250IPR003657WRKY domain
PfamPF031061.2E-17194249IPR003657WRKY domain
Gene3DG3DSA:2.20.25.805.1E-32351426IPR003657WRKY domain
PROSITE profilePS5081132.179361426IPR003657WRKY domain
SuperFamilySSF1182903.53E-27362426IPR003657WRKY domain
SMARTSM007743.0E-35366425IPR003657WRKY domain
PfamPF031067.0E-24368423IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 507 aa     Download sequence    Send to blast
MAEPESFGTH QLGSSNAATE GQEDDEEEMD DSDDESEVDL GGEGGGTGSE FKPTELTTGS  60
SLNEALVTGS LSETLTVASS AENGPSDGLQ PDEGAELKQA PSSHSEPLAV EATQTDKVQE  120
QNRLQLTIFK GPDSDQSPTS VTQSISSYAS SNLSEHKLSP KRVQKICKPE PSQKNFFNHK  180
TPSSVPNART PASDGYNWRK YGQKQVKSPK GSRSYYKCTY SECFAKKIEC CDDSGQTTEI  240
VYKSQHSHDP PRKISTPKES KLVPYVEPVV KKIIAEHSRR VINDSDSPTP SKEPLREAAI  300
VVFERKRQHS NDSNGNDEYK IKDENDDEPG TKQIVKKSSA GNSGTPLKPG KKPKFVVHAA  360
GDVGISGDGY RWRKYGQKMV KGNPHPRNYY RCTSAGCPVR KHIESAVENP NAVIITYKGV  420
HDHDTPVPKK RHGPPSALLV AAAAPASMSS NTQPKKTDVV ESQISSTQWS VDAEGELTGE  480
ALELGGEKAM ESARTLLSIG FEIKPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-25357426877Probable WRKY transcription factor 4
2lex_A2e-25357426877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840090.0GU984009.1 Cucumis sativus WRKY protein (WRKY4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001267648.10.0probable WRKY transcription factor 32-like
SwissprotP595831e-126WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLE7CEV80.0E7CEV8_CUCSA; Uncharacterized protein
STRINGVIT_11s0037g00150.t011e-172(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.11e-104WRKY DNA-binding protein 32
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Ling J, et al.
    Genome-wide analysis of WRKY gene family in Cucumis sativus.
    BMC Genomics, 2011. 12: p. 471
    [PMID:21955985]
  4. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]